PDGFD Antibody - N-terminal region - Biotin
Référence ARP58814_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PDGFD Antibody - N-terminal region : Biotin (ARP58814_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-PDGFD (ARP58814_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFD |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PDGFD (ARP58814_P050-Biotin) antibody is Catalog # AAP58814 (Previous Catalog # AAPP38632) |
| Reference | Liu,G., (2008) Hum. Pathol. 39 (3), 393-402 |
|---|---|
| Gene Symbol | PDGFD |
| Gene Full Name | Platelet derived growth factor D |
| Alias Symbols | IEGF, SCDGFB, MSTP036, SCDGF-B |
| NCBI Gene Id | 80310 |
| Protein Name | Platelet-derived growth factor D |
| Description of Target | The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f |
| Uniprot ID | Q9GZP0 |
| Protein Accession # | NP_079484 |
| Nucleotide Accession # | NM_025208 |
| Protein Size (# AA) | 370 |
| Molecular Weight | 40kDa |
| Protein Interactions | UBC; PDGFRB; |
