PDK2 Antibody - middle region - Biotin
Référence ARP31778_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PDK2 Antibody - middle region : Biotin (ARP31778_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-PDK2 (ARP31778_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Additional Information | IHC Information: Paraffin embedded heart tissue, tested with an antibody dilution of 5 ug/ml. |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDK2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 77%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PDK2 (ARP31778_P050-Biotin) antibody is Catalog # AAP31778 (Previous Catalog # AAPP02569) |
| Sample Type Confirmation | PDK2 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Reference | Hiromasa,Y., (2008) Biochemistry 47 (8), 2312-2324 |
|---|---|
| Gene Symbol | PDK2 |
| Gene Full Name | Pyruvate dehydrogenase kinase, isozyme 2 |
| Alias Symbols | PDHK2, PDKII |
| NCBI Gene Id | 5164 |
| Protein Name | [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial |
| Description of Target | PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism. |
| Uniprot ID | Q15119 |
| Protein Accession # | NP_002602 |
| Nucleotide Accession # | NM_002611 |
| Protein Size (# AA) | 407 |
| Molecular Weight | 44kDa |
| Protein Interactions | VSIG4; DLAT; ISOC2; HIC2; SGK1; PDK2; PDK1; PDHA1; PDHX; AKT1; HTT; |
