PDZRN3 Antibody - middle region - FITC
Référence ARP43178_P050-FITC
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PDZRN3 Antibody - middle region : FITC (ARP43178_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-PDZRN3 (ARP43178_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human PDZRN3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DPYLLPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEVDLYRMNSQDKL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PDZRN3 (ARP43178_P050-FITC) antibody is Catalog # AAP43178 |
| Gene Symbol | PDZRN3 |
|---|---|
| Gene Full Name | PDZ domain containing ring finger 3 |
| Alias Symbols | LNX3, SEMCAP3, SEMACAP3 |
| NCBI Gene Id | 23024 |
| Protein Name | E3 ubiquitin-protein ligase PDZRN3 |
| Description of Target | PDZRN3 is an E3 ubiquitin-protein ligase. It plays an important role in regulating the surface level of MUSK on myotubes. It mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. It might contribute to terminal myogenic differentiation. |
| Uniprot ID | Q9UPQ7-3 |
| Protein Size (# AA) | 729 |
| Molecular Weight | 80kDa |
| Protein Interactions | Dlg4; LNX2; LNX1; UBE2D2; MUSK; PDZRN3; BMPR2; EFNB2; |
