PGF / PlGF, N-His, recombinant protein
Référence NB-21-26021
Conditionnement : 100ug
Conditionnement : 100ug
| Product name | PGF / PlGF, N-His, recombinant protein |
|---|---|
| Uniprot ID | P49763 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECR |
| Molecular weight | 14.91 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% as determined by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu19-Arg131 |
| Protein Accession | P49763 |
| Reference | PX-P5885 |
| Note | For research use only |
| Molecular Constructor | His Leu19–Arg131 |