POLL Antibody - middle region - HRP
Référence ARP54924_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
POLL Antibody - middle region : HRP (ARP54924_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-POLL (ARP54924_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLL |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Yeast: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-POLL (ARP54924_P050-HRP) antibody is Catalog # AAP54924 (Previous Catalog # AAPP31879) |
| Reference | Picher,A.J. (2007) DNA Repair (Amst.) 6 (12), 1749-1756 |
|---|---|
| Gene Symbol | POLL |
| Gene Full Name | Polymerase (DNA directed), lambda |
| Alias Symbols | BETAN, POLKAPPA |
| NCBI Gene Id | 27343 |
| Protein Name | DNA polymerase lambda |
| Description of Target | POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity. |
| Uniprot ID | Q9UGP5 |
| Protein Accession # | NP_037406 |
| Nucleotide Accession # | NM_013274 |
| Protein Size (# AA) | 575 |
| Molecular Weight | 63kDa |
| Protein Interactions | KRTAP10-3; KRTAP10-7; FAM9B; KRT40; FSD2; SSX2IP; TFIP11; PNMA1; TFCP2; MAGEA12; TRIM23; APP; DCUN1D1; REV1; LDOC1; RPA1; PCNA; CDK2; UBE2H; UBE2E1; UBE2D3; UBE2D2; UBE2D1; |
