prgI Recombinant Protein
Référence OPCA02067-100UG
Conditionnement : 100ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PRGI Recombinant Protein (Salmonella typhimurium) (OPCA02067)
| Datasheets/Manuals | Printable datasheet for PRGI Recombinant Protein (Salmonella typhimurium) (OPCA02067) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhimurium |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Salmonella typhimurium |
| Additional Information | Relevance: Required for invasion of epithelial cells. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
| Protein Sequence | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-80 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001) |
|---|---|
| Gene Symbol | prgI |
| Gene Full Name | EscF/YscF/HrpA family type III secretion system needle major subunit |
| Alias Symbols | STM2873. |
| NCBI Gene Id | 1254396 |
| Protein Name | Protein PrgI |
| Description of Target | Required for invasion of epithelial cells. |
| Uniprot ID | P41784 |
| Protein Accession # | NP_461794.1 |
| Nucleotide Accession # | NC_003197.1 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 24.9 kDa |