PTDSS2 antibody - N-terminal region
Référence ARP49960_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PTDSS2 Antibody - N-terminal region (ARP49960_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PTDSS2 (ARP49960_P050) antibody |
|---|
| Publications | StarD7 deficiency switches on glycolysis and promotes mitophagy flux in C2C12 myoblasts Deficient Endoplasmic Reticulum-Mitochondrial Phosphatidylserine Transfer Causes Liver Disease |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PTDSS2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PTDSS2 (ARP49960_P050) antibody is Catalog # AAP49960 (Previous Catalog # AAPP44252) |
| Sample Type Confirmation | PTDSS2 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Gene Symbol | PTDSS2 |
|---|---|
| Gene Full Name | Phosphatidylserine synthase 2 |
| Alias Symbols | PSS2 |
| NCBI Gene Id | 81490 |
| Protein Name | Phosphatidylserine synthase 2 |
| Description of Target | Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]). |
| Uniprot ID | Q9BVG9 |
| Protein Accession # | NP_110410 |
| Nucleotide Accession # | NM_030783 |
| Protein Size (# AA) | 487 |
| Molecular Weight | 56kDa |
| Protein Interactions | HNRNPR; ILF3; UBC; |
