Recombinant Chamaecyparis obtusa Pectate lyase 1 - Yeast
Référence CSB-YP856862CHAX-20ug
Conditionnement : 20ug
Marque : Cusabio
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
| Abbreviation | Recombinant Chamaecyparis obtusa Pectate lyase 1 protein |
| MSDS | |
| Image | |
Product Details
Purity
≥ 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
Pectate lyase 1; EC 4.2.2.2; Major pollen allergen Cha o 1; allergen Cha o 1
Species
Chamaecyparis obtusa (Hinoki false-cypress)
Source
Yeast
Expression Region
22-375aa
Target Protein Sequence
DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to bring the contents to the bottom. Reconstitute the lyophilized protein in sterile deionized water to a recommended concentration of 0.1–1.0 mg/mL. If used immediately after reconstitution, glycerol is not required. If not for immediate use, after the protein is completely dissolved, add glycerol to a final concentration of 5%–50% (default: 50%), aliquot as needed, and store at -20℃/-80℃ for long-term storage. If dilution is needed during subsequent use, dilute with the same buffer as the protein, but without stabilizers (e.g., glycerol, trehalose, etc).
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Customer Reviews and Q&A
■ Customer Reviews
There are currently no reviews for this product.
Target Background
Function
Has pectate lyase activity.
Protein Families
Polysaccharide lyase 1 family, Amb a subfamily