Recombinant Human ApoE4
Référence A121-500
Conditionnement : 500ug
Marque : Leinco Technologies
Recombinant Human ApoE4 (HEK293 Expressed) — Purified No Carrier Protein
Recombinant Human ApoE4 (HEK293 Expressed) — Purified No Carrier Protein
Product No.: A121
Alternate Names ApoE, ApoE, Apolipoprotein E Product Type Recombinant Protein Expression Host HEK293 Cells Applications ELISA ⋅ FA ⋅ WB |
Data
SDSPAGE R: 5µg reduced Recombinant Human ApoE4 (Leinco Prod. No.: A121)
NR: 5µg nonreduced Recombinant Human ApoE4 (Leinco Prod. No.: A121)
Western Blot Purified Recombinant Human ApoE4 (Leinco Prod. No.: A121) was separated on SDSPAGE under both reducing and nonreducing conditions and probed with an antiApoE antibody.
Functional binding of Recombinant Human VLDLR to Recombinant Human ApoE4 (Leinco Prod. No.: A121) Binding was measured by ELISA. Recombinant Human VLDLR was immobilized at 1 µg/mL. Recombinant Human ApoE4 protein was titrated. AntiApoE antibody was used for detection.
Direct binding of antiApoE antibody to Recombinant Human ApoE4 (Leinco Prod. No.: A121) Binding was measured by ELISA. Recombinant Human ApoE4 was immobilized at 1 µg/mL. AntiApoE antibody was titrated.
BackgroundApolipoprotein E (ApoE) is a 299 amino acid protein, produced by the liver and circulating macrophages, that is a constituent of every plasma lipoprotein except the smallest low density lipoproteins (LDL). It is a key player in the recycling and redistribution of lipids and cholesterol. ApoE is a ligand with a high affinity for low density lipoprotein receptors (LDLR). It regulates the activity of enzymes that metabolize lipids and also make lipids soluble. Mice and humans that lack ApoE cannot remove excess lipoproteins from the plasma and have an increased risk of atherosclerosis. Defective binding of ApoE to its receptors will lead to accumulation of cholesterolrich lipoprotein particles in the plasma; this is the cause of type III hyperlipoproteinemia. There are three main isoforms of ApoE all products of alleles at a single gene locus: E2 (Cys112, Cys158), E3 (Cys112, Arg158), and E4 (Arg112, Arg158). Protein DetailsSpecies Human Format Purified No Carrier Protein Purity ≥90% by SDS PAGE Endotoxin Level <1.0 EU/µg Biological Activity ELISA binding Protein Accession No. P02649 Amino Acid Sequence MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH State of Matter Lyophilized SDSPage Molecular Weight 35 kDa Predicted Molecular Mass 34.4 kDa Formulation This lyophilized protein is 0.22 µm sterile filtered and lyophilized from 20 mM Sodium Phosphate, pH 7.8 + 0.5 mM DTT. Reconstitution Reconstitute at 0.11 mg/ml using filtered deionized water. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary. Storage and Stability This lyophilized protein is stable for twelve months when stored at 20°C to 70°C. After aseptic reconstitution, this protein may be stored for one month at 2°C to 8°C or for three months at 20°C to 70°C in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Ambient Ligand/Receptor LowDensity Lipoprotein Receptor (LDLR) Species Human Regulatory Status Research Use Only NCBI Gene Bank UniProt.org P02649 Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA, WB, FA Vous serez peut-être également intéressé par les produits suivants :
Référence
Description
Cond.
Prix HT
|

