Recombinant human Interferon alpha-21
Référence OPCA01252-100UG
Conditionnement : 100ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
IFNA21 Recombinant Protein (Human) (OPCA01252)
| Datasheets/Manuals | Printable datasheet for IFNA21 Recombinant Protein (Human) (OPCA01252) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE |
| Source | Yeast |
| Gene Symbol | IFNA21 |
|---|---|
| Gene Full Name | interferon alpha 21 |
| Alias Symbols | IFN-alpha-21, IFN-alphaI, interferon alpha-21, interferon alpha-F, LeIF F, leIF-F, leukocyte interferon protein. |
| NCBI Gene Id | 3452 |
| Protein Name | Interferon alpha-21 |
| Description of Target | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
| Uniprot ID | P01568 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 21.3 kDa |