Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Recombinant Human ZP3 Protein, N-His

Recombinant Human ZP3 Protein, N-His

Imprimer Imprimer
Identifiez-vous

Référence NB-21-34363

Conditionnement : 100µg

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Recombinant Human ZP3 Protein, N-His

Product name ARO-P16141-100
Uniprot ID P21754
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVG
Molecular weight 23.78 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Thr171-Gly363
Aliases /Synonyms Zona pellucida sperm-binding protein 3, Sperm receptor, ZP3A/ZP3B, Zona pellucida glycoprotein 3, Zp-3, Zona pellucida protein C, Processed zona pellucida sperm-binding protein 3, ZP3, ZP3A, ZP3B, ZPC
Reference ARO-P16141
Note For research use only.
Molecular Constructor
His Thr171–Gly363