SLC9A7 antibody - N-terminal region

Référence ARP44066_P050

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

SLC9A7 Antibody - N-terminal region (ARP44066_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SLC9A7 (ARP44066_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Dog, Goat, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC9A7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Goat: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC9A7 (ARP44066_P050) antibody is Catalog # AAP44066 (Previous Catalog # AAPP25512)
ReferenceLin,P.J., J. Cell. Sci. 118 (PT 9), 1885-1897 (2005)
Gene SymbolSLC9A7
Gene Full NameSolute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Alias SymbolsNHE7, NHE-7, MRX108, SLC9A6
NCBI Gene Id84679
Protein NameSodium/hydrogen exchanger 7
Description of TargetOrganelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.
Uniprot IDQ96T83
Protein Accession #NP_115980
Nucleotide Accession #NM_032591
Protein Size (# AA)725
Molecular Weight80kDa
Protein InteractionsUBC; SCAMP5; SCAMP2; SCAMP1; SLC9A7;

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
A11831-1
 100ul 
CPA2905-30ul
 30ul 
CPA2488-30ul
 30ul