SRP14 Antibody - N-terminal region - HRP
Référence ARP40454_T100-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
SRP14 Antibody - N-terminal region : HRP (ARP40454_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SRP14 (ARP40454_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SRP14 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SRP14 (ARP40454_T100-HRP) antibody is Catalog # AAP40454 (Previous Catalog # AAPS02506) |
| Sample Type Confirmation | SRP14 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Weichenrieder,O., (2000) Nature 408 (6809), 167-173 |
|---|---|
| Gene Symbol | SRP14 |
| Gene Full Name | Signal recognition particle 14kDa (homologous Alu RNA binding protein) |
| Alias Symbols | ALURBP |
| NCBI Gene Id | 6727 |
| Protein Name | Signal recognition particle 14 kDa protein |
| Description of Target | SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding. |
| Uniprot ID | P37108 |
| Protein Accession # | NP_003125 |
| Nucleotide Accession # | NM_003134 |
| Protein Size (# AA) | 136 |
| Molecular Weight | 15kDa |
| Protein Interactions | HUWE1; ITGB1BP2; UBC; MDM2; LIN28A; ASB3; EED; BMI1; PKM; CBS; P3H1; IPO9; NPLOC4; DPP8; LARS; SZRD1; WDR4; PDLIM5; PLIN3; SAE1; UBA2; EIF4A3; ANP32A; SRP9; IGSF8; EEF2K; ICAM1; PAN2; IL7R; FN1; METTL18; SRP54; PRPF19; SRRM2; ACIN1; RPL14; SNRPD1; SNRPA1; |
