SRP54A Antibody - C-terminal region - HRP
Référence ARP40457_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
SRP54A Antibody - C-terminal region : HRP (ARP40457_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SRP54A (ARP40457_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 83%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SRP54A (ARP40457_P050-HRP) antibody is Catalog # AAP40457 |
| Gene Symbol | SRP54A |
|---|---|
| Gene Full Name | signal recognition particle 54A |
| Alias Symbols | Srp54 |
| NCBI Gene Id | 116650 |
| Protein Name | signal recognition particle 54 kDa protein |
| Description of Target | may recognize signal sequences of secretory proteins and may retard them in the endoplasmic reticulum; may regulate synthesis of the secretory protein osteopontin [RGD, Feb 2006] |
| Uniprot ID | Q6AYB5 |
| Protein Accession # | NP_446323 |
| Nucleotide Accession # | NM_053871 |
| Protein Size (# AA) | 504 |
| Molecular Weight | 55kDa |
