SSTR1 Antibody - C-terminal region - HRP
Référence ARP59559_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
SSTR1 Antibody - C-terminal region : HRP (ARP59559_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SSTR1 (ARP59559_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SSTR1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SSTR1 (ARP59559_P050-HRP) antibody is Catalog # AAP59559 (Previous Catalog # AAPP45670) |
| Gene Symbol | SSTR1 |
|---|---|
| Gene Full Name | Somatostatin receptor 1 |
| Alias Symbols | SS1R, SS1-R, SRIF-2, SS-1-R |
| NCBI Gene Id | 6751 |
| Protein Name | Somatostatin receptor type 1 |
| Description of Target | Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biological effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. The encoded protein is a member of the superfamily of somatostatin receptors having seven transmembrane segments, and is expressed in highest levels in jejunum and stomach. |
| Uniprot ID | P28646 |
| Protein Accession # | NP_001040 |
| Nucleotide Accession # | NM_001049 |
| Protein Size (# AA) | 391 |
| Molecular Weight | 43kDa |
| Protein Interactions | SNTA1; PRMT5; SST; CORT; SSTR5; |
