Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Stromal cell-derived factor 1(CXCL12)

Stromal cell-derived factor 1(CXCL12)

Imprimer Imprimer
Identifiez-vous

Référence NB-21-25488

Conditionnement : 50ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Stromal cell-derived factor 1(CXCL12)

Product name Stromal cell-derived factor 1(CXCL12)
Uniprot ID P48061
Uniprot link https://www.uniprot.org/uniprot/P48061
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular weight 8.1kDa
Protein delivered with Tag? No tag
Purity estimated >90% by SDS-PAGE
Buffer PBS，pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Lys89
Protein Accession P48061
Spec:Entrez GeneID 6387
Spec:NCBI Gene Aliases IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
Spec:SwissProtID Q6ICW0
NCBI Reference P48061
Aliases /Synonyms SDF-1,hSDF-1,C-X-C motif chemokine 12,Intercrine reduced in hepatomas,IRH,hIRH,Pre-B cell growth-stimulating factor,PBSF,SDF1, SDF1A, SDF1B
Reference PX-P4857
Note For research use only
Molecular Constructor
Lys22–Lys89 No