Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard

Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard

Imprimer Imprimer
Identifiez-vous

Référence PH319231

Conditionnement : 10ug

Contactez votre distributeur local :


Téléphone :

Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard

Be the first to review this product
SKU
PH319231
TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048)
 

Other products for "Thyrotropin Releasing Hormone or NM_007117"

Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219231
Predicted MW 27.4 kDa
Protein Sequence
Protein Sequence
>RC219231 protein sequence
Red=Cloning site Green=Tags(s)

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009048
RefSeq Size 1890
RefSeq ORF 726
Synonyms Pro-TRH; TRF
Locus ID 7200
UniProt ID P20396
Cytogenetics 3q22.1
Summary This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. provided by RefSeq, May 2013
Protein Families Druggable Genome, Secreted Protein
FAQs
  • Protein FAQs
SDS
SKU Description Size
LC416185 Lyophilized TRH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY416185 Transient overexpression lysate of thyrotropin-releasing hormone (TRH) (as WB positive control) 100 ug
TP319231 Recombinant protein of human thyrotropin-releasing hormone (TRH), 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.