TNF, Recombinant, Bovine, aa74-234, His-Tag (Tumor Necrosis Factor)

Référence 375613-20ug

Conditionnement : 20ug

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790


375613 TNF, Recombinant, Bovine, aa74-234, His-Tag (Tumor Necrosis Factor)

Swiss Prot
Q06599
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Source:
Partial recombinant protein corresponding to aa78-234 from bovine Tumor Necrosis Factor, fused to 6xHis-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~21.4kD

Amino Acid Sequence:
LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ~90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
~90% (SDS-PAGE)
References
1. Cloning and characterization of the tandemly arranged bovine lymphotoxin and tumour necrosis factor-alpha genes. Cludts I., Cleuter Y., Kettmann R., Burny A., Droogmans L.Cytokine 5:336-341(1993).