VSIG4 antibody - N-terminal region
Référence ARP41591_T100
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
VSIG4 Antibody - N-terminal region (ARP41591_T100)
| Datasheets/Manuals | Printable datasheet for anti-VSIG4 (ARP41591_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG4 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 91%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 82%; Rat: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-VSIG4 (ARP41591_T100) antibody is Catalog # AAP41591 (Previous Catalog # AAPP24275) |
| Reference | Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
|---|---|
| Gene Symbol | VSIG4 |
| Gene Full Name | V-set and immunoglobulin domain containing 4 |
| Alias Symbols | CRIg, Z39IG |
| NCBI Gene Id | 11326 |
| Protein Name | V-set and immunoglobulin domain-containing protein 4 |
| Description of Target | T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production. |
| Uniprot ID | Q9Y279 |
| Protein Accession # | NP_009199 |
| Nucleotide Accession # | NM_007268 |
| Protein Size (# AA) | 399 |
| Molecular Weight | 44kDa |
| Protein Interactions | PDK2; nef; APP; C3; |
