WDR66 Antibody - middle region - FITC
Référence ARP52728_P050-FITC
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
WDR66 Antibody - middle region : FITC (ARP52728_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-WDR66 (ARP52728_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human WDR66 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Zebrafish: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: DLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-WDR66 (ARP52728_P050-FITC) antibody is Catalog # AAP52728 |
| Gene Symbol | WDR66 |
|---|---|
| Gene Full Name | WD repeat domain 66 |
| Alias Symbols | WDR66, SPGF33, CaM-IP4 |
| NCBI Gene Id | 144406 |
| Protein Name | WD repeat-containing protein 66 |
| Description of Target | This protein encoded by this gene belongs to the WD repeat-containing family of proteins, which function in the formation of protein-protein complexes in a variety of biological pathways. This family member appears to function in the determination of mean platelet volume (MPV), and polymorphisms in this gene have been associated with variance in MPV. Alternative splicing of this gene results in multiple transcript variants. |
| Uniprot ID | Q8TBY9-3 |
| Protein Size (# AA) | 370 |
| Molecular Weight | 40kDa |
| Protein Interactions | UBC; |
