PX-TA1005
| Product name | Estrogen receptor (in E.coli) |
|---|---|
| Uniprot ID | P03372 |
| Uniprot link | https://www.uniprot.org/uniprot/P03372 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS |
| Molecular weight | 29.47 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met297-Ser554 |
| Protein Accession | P03372 |
| Spec:Entrez GeneID | 2099 |
| Spec:NCBI Gene Aliases | ER; ESR; Era; ESRA; ESTRR; NR3A1 |
| Spec:SwissProtID | Q9UIS7 |
| NCBI Reference | P03372 |
| Aliases /Synonyms | ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1 |
| Reference | PX-P4797 |
| Note | For research use only |
| Molecular Constructor | Met297–Ser554 N terminus His |
| Product name | Estrogen receptor (in E.coli) |
|---|---|
| Uniprot ID | P03372 |
| Uniprot link | https://www.uniprot.org/uniprot/P03372 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS |
| Molecular weight | 29.47 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met297-Ser554 |
| Protein Accession | P03372 |
| Spec:Entrez GeneID | 2099 |
| Spec:NCBI Gene Aliases | ER; ESR; Era; ESRA; ESTRR; NR3A1 |
| Spec:SwissProtID | Q9UIS7 |
| NCBI Reference | P03372 |
| Aliases /Synonyms | ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1 |
| Reference | PX-P4797 |
| Note | For research use only |
| Molecular Constructor | Met297–Ser554 N terminus His |
| Product name | PX-P4797-1MG |
|---|---|
| Uniprot ID | P03372 |
| Uniprot link | https://www.uniprot.org/uniprot/P03372 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS |
| Molecular weight | 29.47 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met297-Ser554 |
| Protein Accession | P03372 |
| Spec:Entrez GeneID | 2099 |
| Spec:NCBI Gene Aliases | ER; ESR; Era; ESRA; ESTRR; NR3A1 |
| Spec:SwissProtID | Q9UIS7 |
| NCBI Reference | P03372 |
| Aliases /Synonyms | ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1 |
| Reference | PX-P4797 |
| Note | For research use only |
| Molecular Constructor | Met297–Ser554 N terminus His |
There are no reviews yet.