Recombinant Human PLCZ1, N-GST

Specifications Recombinant Human PLCZ1, N-GST

Product name	ARO-P12894-100
Uniprot ID	Q86YW0
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
Molecular weight	38.50 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser469-Thr572
Aliases /Synonyms	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1, PLCZ1, Testis-development protein NYD-SP27, Phospholipase C-zeta-1, Phosphoinositide phospholipase C-zeta-1, PLC-zeta-1
Reference	ARO-P12894
Note	For research use only.
Molecular Constructor	Ser469–Thr572

Product name	ARO-P12894-1MG
Uniprot ID	Q86YW0
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
Molecular weight	38.50 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser469-Thr572
Aliases /Synonyms	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1, PLCZ1, Testis-development protein NYD-SP27, Phospholipase C-zeta-1, Phosphoinositide phospholipase C-zeta-1, PLC-zeta-1
Reference	ARO-P12894
Note	For research use only.
Molecular Constructor	Ser469–Thr572

Product name	ARO-P12894-50
Uniprot ID	Q86YW0
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
Molecular weight	38.50 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser469-Thr572
Aliases /Synonyms	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1, PLCZ1, Testis-development protein NYD-SP27, Phospholipase C-zeta-1, Phosphoinositide phospholipase C-zeta-1, PLC-zeta-1
Reference	ARO-P12894
Note	For research use only.
Molecular Constructor	Ser469–Thr572

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human PLCZ1, N-GST” Cancel reply