Recombinant IL-1 beta (Interleukin-1 beta), Human, Animal-Free
Cat# orb1179080-100ug
Size : 100ug
Brand : Biorbyt
Recombinant IL-1 beta (Interleukin-1 beta), Human, AF
View GuideView Protocol
Recombinant IL-1 beta (Interleukin-1 beta), Human, Animal-Free
SKU: orb1179080
Description
Research Area
Immunology & Inflammation
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Origin | Human |
| Biological Activity | Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant human IL-1 beta is approximately >1.5 x 108 IU/mg. Measure by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is 1.8-5.1 ng/mL. |
| Reactivity | Human |
| Tag | His-tag at the N-terminus |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endoge_x005f_x0002_nous Mediator (LEM), Mononuclear Cell Factor (MCF)
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
ELISA
Enzyme-linked Immunosorbent Assay (EIA)


