Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His

Cat# NB-21-32364

Size : 100µg

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Bovine
Uniprot ID:
P02754
Molecular weight:
21.59 kDa
Leu17–Ile178

Specifications Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His

Product name ARO-P11492-100
Uniprot ID P02754
Origin species Bovine
Expression system Prokaryotic expression
Raw Antigen Sequence LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 21.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu17-Ile178
Aliases /Synonyms Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference ARO-P11492
Note For research use only.
Molecular Constructor
Leu17–Ile178
Product name ARO-P11492-1MG
Uniprot ID P02754
Origin species Bovine
Expression system Prokaryotic expression
Raw Antigen Sequence LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 21.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu17-Ile178
Aliases /Synonyms Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference ARO-P11492
Note For research use only.
Molecular Constructor
Leu17–Ile178
Product name ARO-P11492-50
Uniprot ID P02754
Origin species Bovine
Expression system Prokaryotic expression
Raw Antigen Sequence LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Molecular weight 21.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu17-Ile178
Aliases /Synonyms Beta-lactoglobulin, Beta-LG, Bos d 5, LGB
Reference ARO-P11492
Note For research use only.
Molecular Constructor
Leu17–Ile178

Documents

3D Representation

Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Bovine LGB/Beta-lactoglobulin Protein, N-His” Cancel reply

Related products

  • ARO-A14819

    Anti-LGB/Beta-lactoglobulin Antibody (SAA0614)