Thyroglobulin Protein, Human, Recombinant (GST)
Cat# NB-64-127847-200ug
Size : 200ug
Brand : Neo Biotech
Remove All
Thyroglobulin Protein, Human, Recombinant (GST)
(Synonyms: Thyroglobulin, TG) Copy Product InfoSynonyms: Thyroglobulin, TG
Catalog No. TMPH-04553 Copy Product Info
Thyroglobulin Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is P01266.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Thyroglobulin Protein, Human, Recombinant (GST) is expressed in E. coli. The accession number is P01266. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-GST |
| Accession Number | P01266 |
| Amino Acid | IFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTK |
| Construction | 21-300 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Thyroglobulin, TG |
| Molecular Weight | 59.1 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 190 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Thyroglobulin Protein, Human, Recombinant (GST) chemical structure | Thyroglobulin Protein, Human, Recombinant (GST) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

