Peptides bioactifs mitochondriaux

Peptides bioactifs mitochondriaux

Les peptides mitochondriaux sont codés et transcrits par les mitochondries. Ces peptides peuvent jouer un rôle dans les maladies liées à l'âge.

Peptides dérivés des mitochondries (Mitochondrial Derived Peptides ou MDPs)


Miochondrial peptides
Fig 1. Représentation schématique du génome mitochondrial codant pour les MDPs dans les ARNr 16S et 12S.
Des analyses récentes du transcriptome mitochondrial révèlent l'existence de petits ARN avec des cadres de lecture ouverts courts (sORF) dérivés d'ADNmt non détectés auparavant.

Ces SORFS ont conduit à la découverte de MDPs codés et transcrits par les mitochondries.

Ces peptides nouvellement découverts peuvent jouer un rôle clé dans les maladies liées à l'âge telles que le diabète, le cancer, l'athérosclérose, etc.

Actuellement, 8 peptides sont identifiés:
  • Humanin
  • SHLPs (Small Humanin-like peptide) sont six peptides (SHLP1-6) associés à une longévité et une viabilité cellulaire accrues, une apoptose réduite et d'autres fonctions bénéfiques.
  • MOTS-c (pour Mitochondrial open reading frame of the 12S tRNA-c : cadre de lecture ouvert mitochondrial de l'ARNt-c 12S) s'est avéré réduire la résistance à l'insuline, diminuer l'obésité et promouvoir l'homéostasie.

Peptides
Référence
Séquence
MOTS-c
MRWQEMGYIFYPRKLR
Humanine
MAPRGFSCLLLLTSEIDLPVKRRA
SHLP1
MCHWAGGASNTGDARGDVFGKQAG
SHLP3
MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW
SHLP4
MLEVMFLVNRRGKICRVPFTFFNLSL
SHLP6
MLDQDIPMVQPLLKVRLFND

Que peuvent faire les MDP?

Les MDPs, qui ont été identifiés comme étant codés dans les mitochondries, confèrent un nouveau paradigme à la fonction mitochondriale. Ces MDPs (Humanin, MOTS-c et SHLP) peuvent jouer un rôle dans la revitalisation du vieillissement cellulaire dans des états pathologiques tels que le diabète, l'obésité, le cancer, l'athérosclérose et les maladies neurodégénératives:
  • Humanin: Athérosclérose et Alzheimer
  • SHLP: apoptose
  • MOTS-c: Diabète et obésité



MDPs
Fig 1. Schematic representation of the mitochondrial genome encoding the MDPs in the 16S and 12S rRNAs.
Les MDPs sont libérés par les mitochondries dans le cytosol lors d'un stress, stimulés par le vieillissement métabolique ou des mécanismes pathologiques. Les MDPs sont également libérés via une signalisation rétrograde due aux radicaux libres / espèces réactives de l'oxygène (ROS) et à l'influx de calcium.
Par conséquent, la mort cellulaire et la signalisation entraînent une reprise des activités cellulaires normales pour aider à améliorer le vieillissement cellulaire. Une recherche in silico a révélé des peptides supplémentaires dans la même région que l'ADNmt humain. nommés  small humanin‐like peptides (SHLP). Les rôles fonctionnels identifiés pour ces peptides et les mécanismes d'action potentiels diffèrent par leur capacité à réguler la viabilité cellulaire in vitro, et impliquent donc des rôles dans des mécanismes pathologiques tels que l'apoptose.