ADIPOR2 Antibody - C-terminal region

Référence ARP60819_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

ADIPOR2 Antibody - C-terminal region (ARP60819_P050)

Datasheets/ManualsPrintable datasheet for anti-ADIPOR2 (ARP60819_P050) antibody
Product Info
Publications

Cornelian Cherry (Cornus mas L.) Fruit Extract Lowers SREBP-1c and C/EBPα in Liver and Alters Various PPAR-α, PPAR-γ, LXR-α Target Genes in Cholesterol-Rich Diet Rabbit Model

Authors: Danielewski, M., Rapak, A., et al.

Journal: Int J Mol Sci. 25 (2024)

Cornelian Cherry (Cornus mas L.) Fruit Extract Lowers SREBP-1c and C/EBPα in Liver and Alters Various PPAR-α, PPAR-γ, LXR-α Target Genes in Cholesterol-Rich Diet Rabbit Model

Authors: Danielewski, M., Rapak, A., et al.

Journal: Preprints.org. (2023)

Preprint — no PubMed record available

Effects of Obesity on Adiponectin System Skin Expression in Dogs: A Comparative Study

Authors: Dall'Aglio, C., Maranesi, M., et al.

Journal: Animals (Basel). 11 (2021)

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: FPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL
Concentration0.5 mg/ml
Blocking PeptideFor anti-ADIPOR2 (ARP60819_P050) antibody is Catalog # AAP60819
Gene SymbolADIPOR2
Gene Full NameAdiponectin receptor 2
Alias SymbolsPAQR2, ACDCR2
NCBI Gene Id79602
Protein NameAdiponectin receptor protein 2
Description of TargetThe adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Uniprot IDQ86V24
Protein Accession #NP_078827
Nucleotide Accession #NM_024551
Protein Size (# AA)386
Molecular Weight44kDa
Protein InteractionsUBC; APPL1; ADIPOQ;