Conditionnement : 25mg
Téléphone : +1 850 650 7790
Synonyms: Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA
| Description | Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests. |
| Synonyms | Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA |
| Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Storage | Keep away from moisture,Store at low temperature Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 40 mg/mL, Sonication is recommended. |
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO stock solution to 400 µL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|
