ALG12 Antibody - N-terminal region
Référence ARP49805_P050-25UL
Conditionnement : 25ul
Marque : Aviva Systems Biology
ALG12 Antibody - N-terminal region (ARP49805_P050)
| Datasheets/Manuals | Printable datasheet for anti-ALG12 (ARP49805_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALG12 |
| Purification | Affinity purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Goat: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 85%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: EESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLGPVVIAVFSSPAVY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ALG12 (ARP49805_P050) antibody is Catalog # AAP49805 |
| Gene Symbol | ALG12 |
|---|---|
| Gene Full Name | asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae) |
| Alias Symbols | CDG1G, ECM39, hALG12, PP14673 |
| NCBI Gene Id | 79087 |
| Protein Name | Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase |
| Description of Target | This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. |
| Uniprot ID | Q9BV10 |
| Protein Accession # | NP_077010 |
| Protein Size (# AA) | 488 |
| Molecular Weight | 53kDa |
| Protein Interactions | RPL13A; PRDX4; UBC; |


