Alx4 Antibody - middle region - HRP

Référence ARP36820_P050-HRP

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Alx4 Antibody - middle region : HRP (ARP36820_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-Alx4 (ARP36820_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse Alx4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 86%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: EPELPPDSEPVGMDNSYLSVKETGAKGPQDRASAEIPSPLEKTDSESNKG
Concentration0.5 mg/ml
Blocking PeptideFor anti-Alx4 (ARP36820_P050-HRP) antibody is Catalog # AAP36820 (Previous Catalog # AAPP08694)
Gene SymbolAlx4
Gene Full NameAristaless-like homeobox 4
Alias Symbolslst
NCBI Gene Id11695
Protein NameHomeobox protein aristaless-like 4
Description of TargetAlx4 is a transcription factor involved in skull and limb development.
Uniprot IDO35137
Protein Accession #NP_031468
Nucleotide Accession #NM_007442
Protein Size (# AA)399
Molecular Weight43
Protein InteractionsSox10; Gtf3c1; Med16; Tle6; Ercc8; Tbx21; Mixl1; Sox2; Sox15; Rax; Pou4f2; Pou3f4; Prrx1; Pax3; Otx2; Lmx1b; Ldb1; Hoxd13; Hoxd12; Hoxc4; Hoxb13; Hoxa11; Hoxa10; Foxa1; Foxh1; Dlx5; Dlx2; Dlx1; Cdx4; Cdx2; Cdx1; Alx4;