CRBN Antibody - N-terminal region - HRP
Référence ARP56882_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
CRBN Antibody - N-terminal region : HRP (ARP56882_P050-HRP)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-CRBN (ARP56882_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CRBN (ARP56882_P050-HRP) antibody is Catalog # AAP56882 (Previous Catalog # AAPP39828) |
| Reference | 0 |
|---|---|
| Gene Symbol | CRBN |
| Gene Full Name | Cereblon |
| Alias Symbols | MRT2, MRT2A |
| NCBI Gene Id | 51185 |
| Protein Name | Protein cereblon |
| Description of Target | This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio |
| Uniprot ID | Q96SW2 |
| Protein Accession # | NP_057386 |
| Nucleotide Accession # | NM_016302 |
| Protein Size (# AA) | 442 |
| Molecular Weight | 50kDa |
| Protein Interactions | PAK7; RBPMS; MEIS2; DDB1; IKZF3; IKZF1; SUV39H1; KDM1A; UBC; COPS4; COPS6; COPS3; PSMB4; PSMA2; COPS5; CUL4A; PRKAA1; RBX1; |






