CROCCL2 Antibody - N-terminal region

Référence ARP51734_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

CROCCL2 Antibody - N-terminal region (ARP51734_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CROCCP3 (ARP51734_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CROCCL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 83%; Human: 92%; Mouse: 85%; Pig: 92%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CROCCP3 (ARP51734_P050) antibody is Catalog # AAP51734 (Previous Catalog # AAPP40234)
Gene SymbolCROCCP3
Gene Full NameCiliary rootlet coiled-coil, rootletin pseudogene 3
Alias SymbolsCROCCL2, dJ798A10.2
NCBI Gene Id114819
Protein NamePutative ciliary rootlet coiled-coil protein-like 2 protein
Description of TargetCROCCL2 belongs to the rootletin family. The exact functions of CROCCL2 remain unknown.
Uniprot IDQ8IVE0
Protein Accession #XP_057040
Nucleotide Accession #XM_057040
Protein Size (# AA)415
Molecular Weight47kDa

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
CSB-PA887985LA01HU-50ug
 50ug 
A4398-20
 20uL