EGFP Protein - Enhanced green fluorescent protein(egfp)

Référence NB-21-24547

Conditionnement : 50ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Uniprot ID:
C5MKY7
Molecular weight:
32kDa
Met1–Lys239 His

Specifications EGFP Protein - Enhanced green fluorescent protein(egfp)

Product name PX-P4577-1MG
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only.
Molecular Constructor
Met1–Lys239 His
Product name EGFP Protein - Enhanced green fluorescent protein(egfp)
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only
Molecular Constructor
Met1–Lys239 His
Product name EGFP Protein - Enhanced green fluorescent protein(egfp)
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only
Molecular Constructor
Met1–Lys239 His

Description

General information on EGFPprotein

Enhanced green fluorescent protein or EGFP or simply GFP is a protein that exhibit bright green fluorescence when exposed to light in the blue to ultraviolet range. The major advantage of this protein is that it can form internal chromophore whithout requiring any accessory enzymes/substrates, cofactors, gene products other than molecular oxygen. This protein is often used as reporter gene. EGFP can be expressed throughout a given organism, in organs of interest or selected cells. GFP is frequently introduced through transgenic techniques . Regardless, EGFP protein doesn’t affect the genome of the species or that of the offspring. GFP protein has been expressed in a wide range of species including bacteria, fungi, yeast, mammals and even human cells.

The GFP protein is often used as a reporter gene for different essays regarding environmental toxicity levels. Indeed, EGFP protein has been used to demonstrate toxicity levels of different chemicals such as phenol, triclosan, parabens ethanol and p-formaldehyde. The fluroresence is a way of showing how different pollutants can affect the host cells, Another variable that can be easily measured using EGFP protein is the density of cells. A major advantage of EGFP protein is that, depending on how it was introduced in the host cells, in can be heritable. This allows continued study of cells and the tissues where the protein is expressed. Although EGFP protein itself doesn’t interfere with biological processes, it can interact when fused to proteins of interest. Hence, in order to maintain the protein of interest unmodified, careful design of linkers is needed.

In terms of structure, EGFP protein has a soda-shape like structure. It contains a beta barrel that consists of eleven β-strands and a, alpha helix that runs through the center. The beta barrel contains the chromophore which is located in the middle. The alpha helix is covalently bonded to chromophore 4-(p-hydroxybenzylidene)imidazolidin-5-one (HBI). Five shorter alpha helices are located on the ends of the structure.

Documents

3D Representation

EGFP Protein - Enhanced green fluorescent protein(egfp)

Reviews

There are no reviews yet.

Be the first to review “EGFP Protein – Enhanced green fluorescent protein(egfp)” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody