EIF1AX Antibody - middle region - FITC

Référence ARP46055_P050-FITC

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

EIF1AX Antibody - middle region : FITC (ARP46055_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-EIF1AX (ARP46055_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF1AX
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD
Concentration0.5 mg/ml
Blocking PeptideFor anti-EIF1AX (ARP46055_P050-FITC) antibody is Catalog # AAP46055 (Previous Catalog # AAPP26896)
ReferenceKim,S., (2007) Stem Cells Dev. 16 (4), 537-545
Gene SymbolEIF1AX
Gene Full NameEukaryotic translation initiation factor 1A, X-linked
Alias SymbolsEIF1A, EIF4C, eIF-1A, eIF-4C, EIF1AP1
NCBI Gene Id1964
Protein NameEukaryotic translation initiation factor 1A, X-chromosomal
Description of TargetThis gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.
Uniprot IDP47813
Protein Accession #NP_001403
Nucleotide Accession #NM_001412
Protein Size (# AA)144
Molecular Weight16kDa
Protein InteractionsUBC; ADSL; FLII; APP; ELAVL1; DCC; IKBKG; IPO13; EIF5B; EIF3C; EIF2S1; EIF5;