Fibroblast growth factor 1(FGF1) (16-155)

Specifications Fibroblast growth factor 1(FGF1) (16-155)

Product name	Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID	P05230
Uniprot link	https://www.uniprot.org/uniprot/P05230
Expression system	Prokaryotic expression
Raw Antigen Sequence	FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight	17kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe16~Asp155
Protein Accession	P05230
Spec:Entrez GeneID	2246
Spec:NCBI Gene Aliases	AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID	Q16588
NCBI Reference	P05230
Aliases /Synonyms	FGFA,aFGF,ECGF,HBGF-1
Reference	PX-P4884
Note	For research use only
Molecular Constructor	Phe16~Asp155 His

Product name	Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID	P05230
Uniprot link	https://www.uniprot.org/uniprot/P05230
Expression system	Prokaryotic expression
Raw Antigen Sequence	FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight	17kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe16~Asp155
Protein Accession	P05230
Spec:Entrez GeneID	2246
Spec:NCBI Gene Aliases	AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID	Q16588
NCBI Reference	P05230
Aliases /Synonyms	FGFA,aFGF,ECGF,HBGF-1
Reference	PX-P4884
Note	For research use only
Molecular Constructor	Phe16~Asp155 His

Product name	PX-P4884-1MG
Uniprot ID	P05230
Uniprot link	https://www.uniprot.org/uniprot/P05230
Expression system	Prokaryotic expression
Raw Antigen Sequence	FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight	17kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe16~Asp155
Protein Accession	P05230
Spec:Entrez GeneID	2246
Spec:NCBI Gene Aliases	AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID	Q16588
NCBI Reference	P05230
Aliases /Synonyms	FGFA,aFGF,ECGF,HBGF-1
Reference	PX-P4884
Note	For research use only
Molecular Constructor	Phe16~Asp155 His

Documents

• Datasheet
• MSDS

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Fibroblast growth factor 1(FGF1) (16-155)” Cancel reply