GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Mass Spec Standard

Référence PH316541

Conditionnement : 10ug

Contactez votre distributeur local :


Téléphone :

GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Mass Spec Standard

Be the first to review this product
SKU
PH316541
GABRA5 MS Standard C13 and N15-labeled recombinant protein (NP_000801)
 
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216541
Predicted MW 52.1 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC216541
Blue=ORF Red=Cloning site Green=Tag(s)

MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLG
ERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNG
KKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTN
GSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQ
VSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFT
KRGWAWDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSE
SKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC216541 also available, TP316541M
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000801
RefSeq Size 2352
RefSeq ORF 1386
Synonyms DEE79; EIEE79
Locus ID 2558
UniProt ID P31644
Cytogenetics 15q12
Summary GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Transcript variants utilizing three different alternative non-coding first exons have been described. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction
SKU Description Size
LC400284 Lyophilized GABRA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC431938 Lyophilized GABRA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400284 Transient overexpression lysate of gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1 (as WB positive control) 100 ug
LY431938 Transient overexpression lysate of gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2 (as WB positive control) 100 ug
TP316541 Recombinant protein of human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products