GSP1, Recombinant, Saccharomyces cerevisiae, aa2-219, His-Tag (GTP-binding Nuclear Protein GSP1/CNR1)
Référence 373539-100ug
Conditionnement : 100ug
Marque : US Biological
373539 GSP1, Recombinant, Saccharomyces cerevisiae, aa2-219, His-Tag (GTP-binding Nuclear Protein GSP1/CNR1)
Swiss Prot
P32835Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CGTP-binding protein involved in nucleoCytoplasmic domain transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.
Full length recombinant protein corresponding to aa2-219 from saccharomyces cerevisiae (strain ATCC 204508/S288c) GSP1, fused to 6X His-Tag at N-terminal, expressed in Yeast.
Molecular Weight:
~26.7kD
Amino Acid Sequence:
SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

