Hantavirus Protein

Référence orb81638-100ug

Conditionnement : 100ug

Marque : Biorbyt

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Hantavirus Protein

SKU: orb81638

Description

The Hantavirus nucleocapsid (N) fusion protein protein is expressed in E.coli and fused to GST-tag having Mw of 37 kDa. Hantavirus nucleocapsid (N) is conserved among different strains, and is used to test the specific IgM and IgG to Hantavirus.

Images & Validation

Application Notes
Viral Antigens- Hantaan Virus

Key Properties

SourceE.Coli
PurificationPurified by proprietary chromatographic technique.
PurityHTNV protein is >95% pure as determined by 12% PAGE (coomassie staining).
Protein SequenceGSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD

Storage & Handling

StorageStability: Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles
Form/AppearanceSterile filtered colorless solution.
Buffer/PreservativesHTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HTNV, Hantaan Virus, Hantanvirus.
  • Hantavirus GST [orb533530]

    > 95% (SDS-PAGE, 12%, coomassie staining)

    100 μg

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide