HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA)
Référence 127896-50ug
Conditionnement : 50ug
Marque : US Biological
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
127896HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA)
Specifications
Involved in the presentation of foreign antigens to the immune system.
Applications:
Suitable for use in Western Blot and Flow Cytometry. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.