Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)
Référence TMPH-00017-100ug
Conditionnement : 100ug
Marque : TargetMol
Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)
Catalog No. TMPH-00017 Copy Product Info
Holo-ACP synthase Protein, A. laidlawii, Recombinant (His & Myc)
Copy Product InfoTransfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3.

For In stock only · Estimated delivery:EUR Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
View More
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. acpS Protein, Acholeplasma laidlawii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 20.9 kDa and the accession number is A9NHV3. |
| Species | Acholeplasma laidlawii |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | A9NHV3 |
| Synonyms | Holo-ACP synthase,Holo-[acyl-carrier-protein] synthase,acpS,4'-phosphopantetheinyl transferase AcpS |
| Amino Acid | MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV |
| Construction | 1-118 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 20.9 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. |
Dose Conversion
You can also refer to dose conversion for different animals. More


