Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Human CD85d-LILRB2/ILT4 recombinant protein

Human CD85d-LILRB2/ILT4 recombinant protein

Imprimer Imprimer
Identifiez-vous

Référence NB-21-26310

Conditionnement : 100ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Human CD85d-LILRB2/ILT4 recombinant protein

Product name Human CD85d-LILRB2/ILT4 recombinant protein
Uniprot ID Q8N423
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MTPIVTVLICLGLSLGPRTRVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGVV
Molecular weight 50.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Met1-Val461
Aliases /Synonyms CD85 antigen-like family member D, Monocyte/macrophage immunoglobulin-like receptor 10, MIR-10, ILT4, LIR-2, ILT-4, Immunoglobulin-like transcript 4, MIR10, CD85d, Leukocyte immunoglobulin-like receptor subfamily B member 2, Leukocyte immunoglobulin-like receptor 2, LIR2, LILRB2
Reference PX-P6217
Note For research use only
Molecular Constructor
Met1–Val461 His