Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Insulin, Recombinant, Rabbit, aa25-54

Insulin, Recombinant, Rabbit, aa25-54

Imprimer Imprimer
Identifiez-vous

Référence 584974-100ug

Conditionnement : 100ug

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

584974Insulin, Recombinant, Rabbit, aa25-54

Specifications
Swiss ProtP01311
GradePurified
Shipping TempBlue Ice
Storage Temp-20°C

Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Source:
Recombinant protein corresponding to aa25-54 from rabbit Insulin, expressed in E.coli.

Molecular Weight:
~3.4kD

Amino Acid Sequence:
FVNQHLCGSHLVEALYLVCGERGFFYTPKS

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)