Insulin (swine) [12584-58-6]

Référence HY-P3479-100mg

Conditionnement : 100mg

Marque : MedChemExpress

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Description

Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research[1][2][3].

In Vitro

Insulin swine (2 h) causes a concentration-dependent increase in glucose oxidation in swine adipose tissue[1].
Insulin swine (1-1000 ng/mL; 2 h) significantly stimulates lipogenesis in the adipose tissue of80-kg pigs, but does not affect glycerol release[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Insulin swine (1 mg; p.o.; twice a week for 5 weeks and then weekly until 1 year of age) delays the onset and reduces the incidence of diabetes in nonobese diabetic mice[2].
Insulin swine (0.16 U/kg; i.v.) reduces blood glucose levels in diabetic Lewis rats[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Nonobese diabetic mice[2]
Dosage: 1 mg
Administration: Oral gavage (p.o.); twice a week for 5 weeks and then weekly until 1 year of age
Result: Had no metabolic effect on blood glucose levels.
Reduced the severity of lymphocytic infiltration of pancreatic islets.
Generated active cellular mechanisms that suppress disease.
Affected diabetes and the pancreatic cellular inflammatory process.
Masse moléculaire

5777.54

Formule

C256H381N65O76S6

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Chain 1:Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala Chain 2:Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)

Sequence Shortening

Chain 1:FVNQHLCGSHLVEALYLVCGERGFFYTPKA Chain 2:GIVEQCCTSICSLYQLENYCN (Disulfide bridge:1'Cys7-2'Cys7,1'Cys19-2'Cys20,1'Cys6-2'Cys11)

Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvant et solubilité
In Vitro: 

H2O : 20 mg/mL (3.46 mM; ultrasonic and adjust pH to 3 with HCl)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1731 mL 0.8654 mL 1.7308 mL
5 mM --- --- ---
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureté et documentation
Références

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
HY-P3479-50mg
 50mg 
HY-P3479-10mg
 10mg