Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Référence NB-21-24905

Conditionnement : 100ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Product name Isoform SREBP-1C of Sterol regulatory element-binding protein 1
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only
Molecular Constructor
His Met1–Leu466