KLF4, N-His, recombinant protein

Référence NB-21-25942

Conditionnement : 100ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

KLF4, N-His, recombinant protein

Product name KLF4, N-His, recombinant protein
Uniprot ID O43474
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Molecular weight 21.01 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Leu352-Phe513
Protein Accession O43474
Reference PX-P5806
Note For research use only
Molecular Constructor
His Leu352–Phe513