Lefty2 Protein, Mouse, Recombinant (His & Myc)
Référence NB-64-51421-100ug
Conditionnement : 100ug
Marque : Neo Biotech
Remove All
Lefty2 Protein, Mouse, Recombinant (His & Myc)
(Synonyms: Protein lefty-B, Protein lefty-2, Lefty2, Left-right determination factor B, Left-right determination factor 2, Leftb) Copy Product InfoSynonyms: Protein lefty-B, Protein lefty-2, Lefty2, Left-right determination factor B, Left-right determination factor 2, Leftb
Catalog No. TMPH-02752 Copy Product Info
Lefty2 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Lefty2 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P57785 |
| Amino Acid | FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL |
| Construction | 78-368 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Protein lefty-B, Protein lefty-2, Lefty2, Left-right determination factor B, Left-right determination factor 2, Leftb |
| Research Background | Required for left-right asymmetry determination of organ systems in mammals. |
| Molecular Weight | 40.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Protein leftyBProtein lefty2Lefty 2
Related Tags: Lefty2 Protein, Mouse, Recombinant (His & Myc) chemical structure | Lefty2 Protein, Mouse, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

