Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-SUMO-Tag (K3L)

Référence 374878-100ug

Conditionnement : 100ug

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790


374878 Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-SUMO-Tag (K3L)

Swiss Prot
P20639
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Recombinant protein corresponding to aa1-88 from vaccinia virus K3L, fused to His-SUMO-Tag at N-terminal expressed in E. coli.

Molecular Weight:
~26.5kD

Amino Acid Sequence:
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.
Purity
≥90% (SDS-PAGE)
References
1. "Vaccinia virus-encoded eIF-2 alpha homolog abrogates the antiviral effect of interferon." Beattie E., Tartaglia J., Paoletti E.Virology 183:419-422(1991).