Biovalley > RBPJK (RBPJ) (NM_203283) Human Recombinant Protein
RBPJK (RBPJ) (NM_203283) Human Recombinant Protein
Référence TP304791
Conditionnement : 20ug
RBPJK (RBPJ) (NM_203283) Human Recombinant Protein
-
MVProFull-length human proteins expressed in HEK293T cells
Be the first to review this product
SKU
TP304791
Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3, 20 µg
calcActive())">
| Product Data | |
| Species | Human |
|---|---|
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | >RC204791 protein sequence Red=Cloning site Green=Tags(s) MGGCRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKE QMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGV FLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLL DDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTER MYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGG GDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGII YSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Shipping | Dry Ice |
| Reference Data | |
| RefSeq | NP_976028 |
| Locus ID | 3516 |
| UniProt ID | Q06330 |
| Cytogenetics | 4p15.2 |
| RefSeq Size | 5762 |
| RefSeq ORF | 1455 |
| Synonyms | AOS3; CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; RBP-J; RBP-JK; RBP-J kappa; RBPJK; RBPSUH; SUH |
| Summary | The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9. provided by RefSeq, Oct 2013 |
| Protein Categories | Intracellular Proteins, Transciption Factors |
| Protein Families | Transcription Factors |
| Protein Pathways | Notch signaling pathway |
| FAQs |
|
| SDS |
| Recombinant Protein Resources |
| SKU | Description | Size | ||
|---|---|---|---|---|
| PH304791 | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976028) | 10 ug | | |
| PH309094 | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976029) | 10 ug | | |
| LC401647 | Lyophilized RBPJ HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC404367 | Lyophilized RBPJ HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC404368 | Lyophilized RBPJ HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LY401647 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1 (as WB positive control) | 100 ug | | |
| LY404367 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 (as WB positive control) | 100 ug | | |
| LY404368 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4 (as WB positive control) | 100 ug | | |
| TP309094 | Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4, 20 µg | 20 ug | | |
| TP760429 | Purified recombinant protein of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug | | |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

