Recombinant HMPV SH/Small hydrophobic Protein, N-His
Référence NB-21-32948
Conditionnement : 100µg
Conditionnement : 100µg
| Product name | ARO-P15729-100 |
|---|---|
| Uniprot ID | Q6WB95 |
| Origin species | Human metapneumovirus (strain CAN97-83) (HMPV |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | NYIKVENNLQICQSKTESDKEDSPSNTTSVTTKTTLDHDITQYFKRLIQRYTDSVINKDTCWKISRNQCTNITTYKFLCFKPEDSKINSCDRLTDLCRNKSKSAAEAYHTVECHCIYTIEWKCYHHSID |
| Molecular weight | 17.44 kDa |
| Protein delivered with Tag? | N-Terminal His Tag |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Asn51-Asp179 |
| Aliases /Synonyms | Small hydrophobic protein, SH |
| Reference | ARO-P15729 |
| Note | For research use only. |
| Molecular Constructor | His Asn51–Asp179 |