- Host species:
- Escherichia coli (E.coli)
- Origin species:
- Human
- Uniprot ID:
- P26358
- Molecular weight:
- 22.56 kDa
Arg730–Ile907
Conditionnement : 100µg
| Product name | ARO-P12602-100 |
|---|---|
| Uniprot ID | P26358 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI |
| Molecular weight | 22.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg730-Ile907 |
| Aliases /Synonyms | CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9 |
| Reference | ARO-P12602 |
| Note | For research use only. |
| Molecular Constructor | Arg730–Ile907 |
| Product name | ARO-P12602-1MG |
|---|---|
| Uniprot ID | P26358 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI |
| Molecular weight | 22.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg730-Ile907 |
| Aliases /Synonyms | CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9 |
| Reference | ARO-P12602 |
| Note | For research use only. |
| Molecular Constructor | Arg730–Ile907 |
| Product name | ARO-P12602-50 |
|---|---|
| Uniprot ID | P26358 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | RISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEI |
| Molecular weight | 22.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg730-Ile907 |
| Aliases /Synonyms | CXXC-type zinc finger protein 9, MCMT, AIM, DNMT1, DNA MTase HsaI, DNMT, DNA (cytosine-5)-methyltransferase 1, Dnmt1, DNA methyltransferase HsaI, M.HsaI, CXXC9 |
| Reference | ARO-P12602 |
| Note | For research use only. |
| Molecular Constructor | Arg730–Ile907 |
There are no reviews yet.